porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 124801 - 124900 out of 482365 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
chinakenyasourcing.top top 3d, 16h 1.00 1.00 0 0 0.00 -
chinakinmed.mom mom 25d, 16h 1.00 1.00 0 0 0.00 -
chinakorex.co co 1d, 16h 1.00 1.00 0 0 0.00 -
chinalishen.com com 15d, 16h 1.00 1.00 0 0 0.00 -
china-medical-devices.com com 1d, 16h 1.00 1.00 0 0 0.00 -
chinamews.com com 23d, 16h 1.02 1.02 0 0 0.00 -
chinamonitor.cc cc 21d, 16h 1.00 1.00 0 0 0.00 -
chinanflonlinejerseys.xyz xyz 1h, 20m 1.00 1.00 0 0 0.00 -
chinanumber.one one 5d, 21h 7.99 7.99 0 1 0.00 -
china-pcb-778578438.click click 2d, 20h 7.99 7.99 0 1 0.00 -
chinapost.eu eu 5d, 7h 100.00 100.00 0 0 0.00 -
chinaposttracking.info info 13d, 16h 1.00 1.00 0 0 0.00 -
china-print.com com 1d, 16h 1.00 1.00 0 0 0.00 -
china-print.net net 1d, 16h 1.00 1.00 0 0 0.00 -
chinaqartytent.com com 13d, 16h 1.00 1.00 0 0 0.00 -
chinaqz.org org 18h, 32m 7.99 7.99 0 1 0.00 -
chinaready.com com 25d, 16h 1.00 21.00 5 0 0.00 -
chinarights.org org 7d, 16h 1.00 1.00 0 0 0.00 -
china-runwin-led.com com 4d, 16h 1.00 1.00 0 0 0.00 -
chinasdfig.com com 4d, 1h 7.99 7.99 0 2 0.00 -
chinashihuan.com com 4d, 1h 7.99 7.99 0 2 0.00 -
chinashophub.com com 1d, 21h 7.99 7.99 0 1 0.00 -
chinashopx.com com 1d, 21h 7.99 7.99 0 1 0.00 -
chinashuntai.com com 1d, 21h 7.99 7.99 0 8 0.00 -
chinaskit.com com 10d, 16h 1.00 1.00 0 0 0.00 -
chinasljcj.com com 16h, 20m 1.00 1.00 0 0 0.00 -
china-stainless-817419496.click click 4d, 17h 7.99 7.99 0 1 0.00 -
chinastockx.com com 5d, 18h 7.99 7.99 0 2 0.00 -
chinasunhorse.com com 10d, 16h 1.00 1.00 0 0 0.00 -
china-sunlight.com com 5d, 16h 1.00 1.00 0 0 0.00 -
chinatelecoms.life life 17d, 16h 1.00 1.00 0 0 0.00 -
chinatjrich.com com 18d, 16h 1.00 1.00 0 0 0.00 -
chinatmt.org org 28d, 16h 1.00 1.00 0 0 0.00 -
chinatown.cool cool 1h, 20m 1.00 1.00 0 0 0.00 -
chinatravelbizsolutions.com com 5d, 16h 1.00 1.00 0 0 0.00 -
china-urcc.com com 9d, 16h 1.00 1.00 0 0 0.00 -
chinav5.bid bid 22d, 16h 1.00 1.00 0 0 0.00 -
chinavibratingsieve.com com 19d, 16h 1.00 1.00 0 0 0.00 -
chinavip1.com com 20d, 16h 1.00 1.00 0 0 0.00 -
china-white.com com 8d, 21h 7.99 7.99 0 1 0.00 -
china-wholesale-751758407.click click 4d, 19h 7.99 7.99 0 1 0.00 -
china-wholesale-813002876.click click 3d, 21h 7.99 7.99 0 1 0.00 -
chinawsht.com com 3d, 21h 7.99 7.99 0 1 0.00 -
chinaxmall.com com 2d, 21h 7.99 7.99 0 1 0.00 -
chinayouarethebest.top top 19d, 16h 1.00 1.00 0 0 0.00 -
chin.best best 2d, 20h 7.99 7.99 0 1 0.00 -
chindo138.info info 8d, 16h 1.00 1.00 0 0 0.00 -
chinelada.com com 6d, 1h 1.00 1.00 0 0 0.00 -
chinelos-brasil.online online 22d, 16h 1.00 1.00 0 0 0.00 -
chineseantiques.net net 21h, 20m 7.99 7.99 0 2 0.00 -
chineseburners.com com 17d, 16h 1.00 1.00 0 0 0.00 -
chinese-cars-139947197.click click 3d, 17h 7.99 7.99 0 1 0.00 -
chinesemandarinclass.com com 4d, 1h 7.99 7.99 0 1 0.00 -
chineseoutfits.travel travel 5d, 19h 7.99 7.99 0 1 0.00 -
chineseoutfit.travel travel 5d, 19h 7.99 7.99 0 1 0.00 -
chinese.quest quest 5d, 21h 7.99 7.99 0 5 0.00 -
chinesery.com com 4d, 1h 7.99 7.99 0 1 0.00 -
chinese-schools-cn-agent.click click 2d, 20h 7.99 7.99 0 1 0.00 -
chineseskillset.com com 9d, 21h 7.99 7.99 0 2 0.00 -
chinesetalismans.com com 18d, 16h 1.00 1.00 0 0 0.00 -
chinese-teach-tw-agent.click click 2d, 17h 7.99 7.99 0 1 0.00 -
chinesetest.cfd cfd 26d, 16h 1.00 1.00 0 0 0.00 -
chinesetradings.com com 6d, 17h 7.99 7.99 0 1 0.00 -
chinesex.xyz xyz 23d, 16h 1.00 1.00 0 0 0.00 -
chinesischemedizin.info info 9d, 1h 1.00 1.00 0 0 0.00 -
chinfaa.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfad.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfaf.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfag.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfah.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfaj.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfap.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfaw.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfax.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chinfay.com com 28d, 16h 1.00 1.00 0 0 0.00 -
chingado.com com 4d, 21h 1,505.00 1,505.00 0 16 0.00 -
chingy-a.top top 24d, 16h 1.00 1.00 0 0 0.00 -
chinlady.com com 6d, 16h 1.00 1.00 0 0 0.00 -
chin-liposuction.top top 21d, 16h 1.00 1.00 0 0 0.00 -
chinodryerventcleaning.us us 16h, 20m 1.00 1.00 0 0 0.00 -
chinogaragedoorrepair.us us 16h, 20m 1.00 1.00 0 0 0.00 -
chinohillsdryerventcleaning.us us 16h, 20m 1.00 1.00 0 0 0.00 -
chinohillsgaragedoorrepair.us us 16h, 20m 1.00 1.00 0 0 0.00 -
chiodokennels.com com 8d, 16h 1.00 1.00 0 0 0.00 -
chiofikanocera.sbs sbs 19d, 16h 1.00 1.00 0 0 0.00 -
chipandcrinkle.com com 1d, 21h 7.99 7.99 0 2 0.00 -
chipcharmer.com com 3d, 21h 7.99 7.99 0 2 0.00 -
chipdale.com com 23d, 16h 1.00 1.00 0 0 0.00 -
chip.financial financial 4d, 20h 7.99 7.99 0 1 0.00 -
chipforyou.com com 3d, 20h 7.99 7.99 0 5 0.00 -
chip-fuse.com com 6d, 16h 1.00 1.00 0 0 0.00 -
chipmong.net net 7d, 16h 1.00 1.00 0 0 0.00 -
chipmunksolana.top top 22d, 16h 1.00 1.00 0 0 0.00 -
chipnap.info info 2d, 21h 15.00 15.00 0 1 0.00 -
chipnap.online online 3d, 16h 15.00 15.00 0 1 0.00 -
chipnex.com com 2d, 18h 7.99 7.99 0 1 0.00 -
chipotlesmenus.management management 4d, 20h 7.99 7.99 0 1 0.00 -
chipped.cash cash 9d, 16h 1.00 1.00 0 0 0.00 -
chippewalakedryerventcleaning.us us 1d, 16h 1.00 1.00 0 0 0.00 -
chippewalakegaragedoorrepair.us us 16h, 20m 1.00 1.00 0 0 0.00 -

Showing 124801 - 124900 out of 482365 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig