porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 126801 - 126900 out of 483398 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
chinaskit.com com 9d, 17h 1.00 1.00 0 0 0.00 -
chinasolarled.com com 28d, 17h 1.00 1.00 0 0 0.00 -
chinaspora.com com 9d, 22h 7.99 7.99 0 1 0.00 -
china-stainless-817419496.click click 3d, 18h 7.99 7.99 0 1 0.00 -
chinastockx.com com 4d, 18h 7.99 7.99 0 2 0.00 -
chinasunhorse.com com 9d, 17h 1.00 1.00 0 0 0.00 -
china-sunlight.com com 4d, 17h 1.00 1.00 0 0 0.00 -
chinatelecoms.life life 16d, 17h 1.00 1.00 0 0 0.00 -
chinatjrich.com com 17d, 17h 1.00 1.00 0 0 0.00 -
chinatmt.org org 27d, 17h 1.00 1.00 0 0 0.00 -
chinatoday.us us 9d, 2h 1.00 1.00 0 0 0.00 -
chinatravelbizsolutions.com com 4d, 17h 1.00 1.00 0 0 0.00 -
china-urcc.com com 8d, 17h 1.00 1.00 0 0 0.00 -
chinav5.bid bid 21d, 17h 1.00 1.00 0 0 0.00 -
chinavibratingsieve.com com 18d, 17h 1.00 1.00 0 0 0.00 -
chinavip1.com com 19d, 17h 1.00 1.00 0 0 0.00 -
china-warehouse.com com 6d, 22h 5.00 5.00 0 1 0.00 479
china-white.com com 7d, 22h 7.99 7.99 0 1 0.00 -
china-wholesale-751758407.click click 3d, 20h 7.99 7.99 0 1 0.00 -
china-wholesale-813002876.click click 2d, 22h 7.99 7.99 0 1 0.00 -
chinawsht.com com 2d, 22h 7.99 7.99 0 1 0.00 -
chinaxmall.com com 1d, 22h 7.99 7.99 0 1 0.00 -
chinayouarethebest.top top 18d, 17h 1.00 1.00 0 0 0.00 -
chinazesnews.com com 28d, 17h 1.00 1.00 0 0 0.00 -
chin.best best 1d, 21h 7.99 7.99 0 1 0.00 -
chindo138.info info 7d, 17h 1.00 1.00 0 0 0.00 -
chinelada.com com 5d, 2h 1.00 1.00 0 0 0.00 -
chinelos-brasil.online online 21d, 17h 1.00 1.00 0 0 0.00 -
chinese886.com com 5d, 22h 7.99 7.99 0 2 0.00 -
chineseburners.com com 16d, 17h 1.00 1.00 0 0 0.00 -
chinese-cars-139947197.click click 2d, 18h 7.99 7.99 0 1 0.00 -
chinesemandarinclass.com com 3d, 2h 7.99 7.99 0 1 0.00 -
chineseoutfits.travel travel 4d, 20h 7.99 7.99 0 1 0.00 -
chineseoutfit.travel travel 4d, 20h 7.99 7.99 0 1 0.00 -
chinese.quest quest 4d, 22h 7.99 7.99 0 5 0.00 -
chinesery.com com 3d, 2h 7.99 7.99 0 1 0.00 -
chinese-schools-cn-agent.click click 1d, 21h 7.99 7.99 0 1 0.00 -
chineseskillset.com com 8d, 22h 7.99 7.99 0 2 0.00 -
chinesetalismans.com com 17d, 17h 1.00 1.00 0 0 0.00 -
chinese-teach-tw-agent.click click 1d, 18h 7.99 7.99 0 1 0.00 -
chinesetest.cfd cfd 25d, 17h 1.00 1.00 0 0 0.00 -
chinesetradings.com com 5d, 18h 7.99 7.99 0 1 0.00 -
chinesetranslationpartner.com com 28d, 17h 1.00 1.00 0 0 0.00 -
chinesex.xyz xyz 22d, 17h 1.00 1.00 0 0 0.00 -
chinesischemedizin.info info 8d, 2h 1.00 1.00 0 0 0.00 -
chinfaa.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfad.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfaf.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfag.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfah.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfaj.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfap.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfaw.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfax.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chinfay.com com 27d, 17h 1.00 1.00 0 0 0.00 -
chingado.com com 3d, 21h 1,505.00 1,505.00 0 16 0.00 -
chingy-a.top top 23d, 17h 1.00 1.00 0 0 0.00 -
chinlady.com com 5d, 17h 1.00 1.00 0 0 0.00 -
chin-liposuction.top top 20d, 17h 1.00 1.00 0 0 0.00 -
chiodokennels.com com 7d, 17h 1.00 1.00 0 0 0.00 -
chiofikanocera.sbs sbs 18d, 17h 1.00 1.00 0 0 0.00 -
chipandcrinkle.com com 22h, 12m 7.99 7.99 0 2 0.00 -
chipcharmer.com com 2d, 22h 7.99 7.99 0 2 0.00 -
chipdale.com com 22d, 17h 1.00 1.00 0 0 0.00 -
chip.financial financial 3d, 21h 7.99 7.99 0 1 0.00 -
chipflip.org org 6d, 20h 7.99 7.99 0 1 0.00 -
chipforyou.com com 2d, 21h 7.99 7.99 0 5 0.00 -
chip-fuse.com com 5d, 17h 1.00 1.00 0 0 0.00 -
chipmong.net net 6d, 17h 1.00 1.00 0 0 0.00 -
chipmongogoe41.buzz buzz 28d, 17h 1.00 1.00 0 0 0.00 -
chipmunksolana.top top 21d, 17h 1.00 1.00 0 0 0.00 -
chipnap.info info 1d, 22h 15.00 15.00 0 1 0.00 -
chipnap.online online 2d, 17h 15.00 15.00 0 1 0.00 -
chipnex.com com 1d, 18h 7.99 7.99 0 1 0.00 -
chipotlesmenus.management management 3d, 20h 7.99 7.99 0 1 0.00 -
chipped.cash cash 8d, 17h 1.00 1.00 0 0 0.00 -
chippewalakedryerventcleaning.us us 17h, 12m 1.00 1.00 0 0 0.00 -
chipsflowkit.com com 1d, 22h 200.00 200.00 0 1 0.00 -
chipsloop.com com 1d, 22h 50.00 50.00 0 1 0.00 -
chipversion.com com 5d, 19h 7.99 7.99 0 1 0.00 -
chipwave.org org 1d, 17h 1.00 1.00 0 0 0.00 -
chiragpsmart.info info 1d, 22h 5.00 5.00 0 1 0.00 11
chirastore.com com 8d, 22h 7.99 7.99 0 1 0.00 -
c-hireepersonnel.us us 15d, 17h 1.00 1.00 0 0 0.00 -
chirenshengzaihechuwu.top top 2d, 17h 1.00 1.00 0 0 0.00 -
chirobachi.com com 4d, 2h 7.99 7.99 0 3 0.00 -
chirogrowthagency.com com 9d, 22h 7.99 7.99 0 1 0.00 -
chirohelp.net net 24d, 17h 1.00 1.00 0 0 0.00 -
chiropractic90024.com com 26d, 17h 1.00 1.00 0 0 0.00 -
chiropracticcoupon.com com 9d, 22h 7.99 7.99 0 3 0.00 1
chiropractic-near-me.sbs sbs 16d, 17h 1.00 1.00 0 0 0.00 -
chiropractic-services064746.icu icu 2d, 22h 7.99 7.99 0 n/a 0.00 -
chiropractic-services111230.icu icu 1d, 21h 7.99 7.99 0 n/a 0.00 -
chiropractic-services240056.icu icu 2d, 22h 7.99 7.99 0 n/a 0.00 -
chiropractic-services446877.icu icu 1d, 21h 7.99 7.99 0 n/a 0.00 -
chiropractic-services999298.icu icu 1d, 21h 7.99 7.99 0 n/a 0.00 -
chiropractor90024.com com 26d, 17h 1.00 1.00 0 0 0.00 -
chiropractornearby182977.icu icu 3d, 21h 7.99 7.99 0 n/a 0.00 -
chiropractornearme008047.icu icu 2d, 22h 7.99 7.99 0 n/a 0.00 -
chiropractornearme010685.icu icu 2d, 22h 7.99 7.99 0 n/a 0.00 -

Showing 126801 - 126900 out of 483398 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig