porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 139701 - 139800 out of 481511 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
southozoneparkchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
southplainfieldchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
southrichmondhillchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
soyneuropsicologa.com com 4d, 17h 1.00 1.00 0 0 0.00 -
soz2pk.us us 4d, 17h 1.00 1.00 0 0 0.00 -
sp7izm.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spaceallsearch.top top 4d, 17h 1.00 1.00 0 0 0.00 -
spacemail.org org 4d, 17h 1.00 1.00 0 0 0.00 -
spandabuy.co co 4d, 17h 1.00 1.00 0 0 0.00 -
sparrowspointchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spawellnessmagazin.com com 4d, 17h 1.00 1.00 0 0 0.00 -
specials.top top 4d, 17h 1.00 1.00 0 0 0.00 -
spectrum-coverage-map.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
spectrum-near-me.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
spectrum-store-near-me.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
specttech.store store 4d, 17h 1.00 1.00 0 0 0.00 -
speedibook.com com 4d, 17h 1.00 1.00 0 0 0.00 -
speedplus.info info 4d, 17h 1.00 1.00 0 0 0.00 -
spicynewsletter.top top 4d, 17h 1.00 1.00 0 0 0.00 -
spicynews.top top 4d, 17h 1.00 1.00 0 0 0.00 -
spiderman.life life 4d, 17h 1.00 1.00 0 0 0.00 -
spinningcat.top top 4d, 17h 1.00 1.00 0 0 0.00 -
spiqw2.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spmoju.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spoepe.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spotify-web-player.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
spotswoodchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spreearchitect.online online 4d, 17h 1.00 1.00 0 0 0.00 -
springchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
springfieldgardenschimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
springvalleychimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spxxkl.us us 4d, 17h 1.00 1.00 0 0 0.00 -
spystories.net net 4d, 17h 1.00 1.00 0 0 0.00 -
spywaretoday.com com 4d, 17h 1.00 1.00 0 0 0.00 -
sq56cn.us us 4d, 17h 1.00 1.00 0 0 0.00 -
squawvalleychimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
sqvqp.run run 4d, 17h 1.00 1.00 0 0 0.00 -
sqyzhgtoold.buzz buzz 4d, 17h 1.00 1.00 0 0 0.00 -
sr2llm.us us 4d, 17h 1.00 1.00 0 0 0.00 -
sratqh.us us 4d, 17h 1.00 1.00 0 0 0.00 -
srm6iw.us us 4d, 17h 1.00 1.00 0 0 0.00 -
srtc218.com com 4d, 17h 1.00 1.00 0 0 0.00 -
ss1e2t.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssazky.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssba436.xyz xyz 4d, 17h 1.00 1.00 0 0 0.00 -
ssboshi33.homes homes 4d, 17h 1.00 1.00 0 0 0.00 -
ssbtindustries.com com 4d, 17h 1.00 1.00 0 0 0.00 -
ssfgamers.top top 4d, 17h 1.00 1.00 0 0 0.00 -
sshw13.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssib1b.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssonlinebd.com com 4d, 17h 1.00 1.00 0 0 0.00 -
ssp594.xyz xyz 4d, 17h 1.00 1.00 0 0 0.00 -
sspeup.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssyjsy.top top 4d, 17h 1.00 1.00 0 0 0.00 -
ssyp97.us us 4d, 17h 1.00 1.00 0 0 0.00 -
ssz8eg.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stacesa.life life 4d, 17h 1.00 1.00 0 0 0.00 -
stactezal.vip vip 4d, 17h 1.00 1.00 0 0 0.00 -
stanhopechimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stanhub.top top 4d, 17h 1.00 1.00 0 0 0.00 -
stantonchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
starflare.life life 4d, 17h 1.00 1.00 0 0 0.00 -
stark-law.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
starkoan.com com 4d, 17h 1.00 1.00 0 0 0.00 -
starseass.top top 4d, 17h 1.00 1.00 0 0 0.00 -
state-farm-home-insurance-coverage.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
steak.icu icu 4d, 17h 1.00 1.00 0 0 0.00 -
steamexpress.top top 4d, 17h 1.00 1.00 0 0 0.00 -
stevemaddensale.com com 4d, 17h 1.00 1.00 0 0 0.00 -
stevemsbuilds.com com 4d, 17h 1.00 1.00 0 0 0.00 -
stevensonranchchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
sthtbc.top top 4d, 17h 1.00 1.00 0 0 0.00 -
stiureoter.top top 4d, 17h 1.00 1.00 0 0 0.00 -
stlbxk.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stockholmchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stockinvestglobal.info info 4d, 17h 1.00 1.00 0 0 0.00 -
stocksandfriends.com com 4d, 17h 1.00 1.00 0 0 0.00 -
stockscpa.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
stoicallytyped.com com 4d, 17h 1.00 1.00 0 0 0.00 -
stokex.me me 4d, 17h 1.00 1.00 0 0 0.00 -
stoneparkchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stoneswar.io io 4d, 17h 1.00 1.00 0 0 0.00 -
stop-sign.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
store-content.com com 4d, 17h 1.00 1.00 0 0 0.00 -
storyline-online.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
stpatrickscathedralado.org org 4d, 17h 1.00 1.00 0 0 0.00 -
streetchimneysweep.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stridwedding.com com 4d, 17h 1.00 1.00 0 0 0.00 -
stronstech.com com 4d, 17h 1.00 1.00 0 0 0.00 -
struckbylight.net net 4d, 17h 1.00 1.00 0 0 0.00 -
stsguh.us us 4d, 17h 1.00 1.00 0 0 0.00 -
stu4rt.com com 4d, 17h 1.00 1.00 0 0 0.00 -
student-portal.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
studentreliefprogram.org org 4d, 17h 1.00 1.00 0 0 0.00 -
studie10-be.com com 4d, 17h 1.00 1.00 0 0 0.00 -
studio-ghibli-movies.cfd cfd 4d, 17h 1.00 1.00 0 0 0.00 -
stwsystem.top top 4d, 17h 1.00 1.00 0 0 0.00 -
stylevistaua.click click 4d, 17h 1.00 1.00 0 0 0.00 -
stylevistaua.help help 4d, 17h 1.00 1.00 0 0 0.00 -
stylevistaua.icu icu 4d, 17h 1.00 1.00 0 0 0.00 -

Showing 139701 - 139800 out of 481511 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig