porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 271101 - 271200 out of 482345 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
cfpj71.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cfpw2z.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cfxs123.com com 10d, 21h 1.00 1.00 0 0 0.00 -
cfy45w.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cg28s4.top top 10d, 21h 1.00 1.00 0 0 0.00 -
cg827s.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cgdd.cc cc 10d, 21h 1.00 1.00 0 0 0.00 -
cgfpwq.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cgjum4.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cgwnap.us us 10d, 21h 1.00 1.00 0 0 0.00 -
ch4rft.us us 10d, 21h 1.00 1.00 0 0 0.00 -
ch7jx2.us us 10d, 21h 1.00 1.00 0 0 0.00 -
ch7m4r.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chaddsfordairductcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chaincryptopulse.com com 10d, 21h 1.00 1.00 0 0 0.00 -
championswa.org org 10d, 21h 1.00 1.00 0 0 0.00 -
channelviewdryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chargedesk.help help 10d, 21h 1.00 1.00 0 0 0.00 -
charge-esl-org.xyz xyz 10d, 21h 1.00 1.00 0 0 0.00 -
charlescitydryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
charlottehallairductcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
charlottehalldryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chase-near-me.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
chatfetch.cc cc 10d, 21h 1.00 1.00 0 0 0.00 -
cheap-hotel-booking.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
cheirxoen.sbs sbs 10d, 21h 1.00 1.00 0 0 0.00 -
chejy0.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cheltenhamairductcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cheltenhamgaragedoorrepair.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chemohra.com com 10d, 21h 1.00 1.00 0 0 0.00 -
cherenok.pro pro 10d, 21h 1.00 1.00 0 0 0.00 -
cherykiller.top top 10d, 21h 1.00 1.00 0 0 0.00 -
cheswickgaragedoorrepair.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chg22t.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chicagobodyrubs.fun fun 10d, 21h 1.00 1.00 0 0 0.00 -
chicagoheightsdryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chicago-med-where-to-watch.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
chicago-pizza.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
chicagoridgedryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chickengame.me me 10d, 21h 1.00 1.00 0 0 0.00 -
chickeninspectionfacts.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chickenroadturkey.sbs sbs 10d, 21h 1.00 1.00 0 0 0.00 -
chickkstheuk.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chidogo.mx mx 10d, 21h 1.00 1.00 0 0 0.00 -
child-care.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
child-care-near-me.cfd cfd 10d, 21h 1.00 1.00 0 0 0.00 -
chilingacg.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chimpsap.com com 10d, 21h 1.00 1.00 0 0 0.00 -
china-aircornpressor.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chinabarbour.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chinakorex.co co 10d, 21h 1.00 1.00 0 0 0.00 -
china-medical-devices.com com 10d, 21h 1.00 1.00 0 0 0.00 -
china-print.com com 10d, 21h 1.00 1.00 0 0 0.00 -
china-print.net net 10d, 21h 1.00 1.00 0 0 0.00 -
chippewalakedryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
chnkivi.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chosethrds.com com 10d, 21h 1.00 1.00 0 0 0.00 -
christhoodministries.org org 10d, 21h 1.00 1.00 0 0 0.00 -
chromalix.com com 10d, 21h 1.00 1.00 0 0 0.00 -
chronic-disease-management.top top 10d, 21h 1.00 1.00 0 0 0.00 -
chxcxous.sbs sbs 10d, 21h 1.00 1.00 0 0 0.00 -
ci6eix.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cijs38.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cindyselect.com com 10d, 21h 1.00 1.00 0 0 0.00 -
cinezzz.link link 10d, 21h 1.00 1.00 0 0 0.00 -
cintaspartnerconnect.online online 10d, 21h 1.00 1.00 0 0 0.00 -
cipvsy.us us 10d, 21h 1.00 1.00 0 0 0.00 -
circularwise.pics pics 10d, 21h 1.00 1.00 0 0 0.00 -
citihkl.com com 10d, 21h 1.00 1.00 0 0 0.00 -
cjcaol.pics pics 10d, 21h 1.00 1.00 0 0 0.00 -
cjcnug.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cje20g.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cjhrzi.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cjn9a4.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cjxb8c.top top 10d, 21h 1.00 1.00 0 0 0.00 -
ck7rue.xyz xyz 10d, 21h 1.00 1.00 0 0 0.00 -
cke8y5.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cl7to4.us us 10d, 21h 1.00 1.00 0 0 0.00 -
claim-jocker.xyz xyz 10d, 21h 1.00 1.00 0 0 0.00 -
claimpinkfinance.top top 10d, 21h 1.00 1.00 0 0 0.00 -
claims-modulss.xyz xyz 10d, 21h 1.00 1.00 0 0 0.00 -
clara-mx.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clarasolana.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clarendonhillsdryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
clarivatecrmgthrgroup.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clarkeintemational.com com 10d, 21h 1.00 1.00 0 0 0.00 -
claytondryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
cleanerair-today-5022.top top 10d, 21h 1.00 1.00 0 0 0.00 -
cleanerair-today-8182.top top 10d, 21h 1.00 1.00 0 0 0.00 -
cleanskytrading.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clearfielddryerventcleaning.us us 10d, 21h 1.00 1.00 0 0 0.00 -
clickandcollections.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clickchicks.com com 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-1223.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-1738.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-234.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-5022.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-5552.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -
clinical-trials-reporter-6709.bond bond 10d, 21h 1.00 1.00 0 0 0.00 -

Showing 271101 - 271200 out of 482345 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig