porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 276401 - 276500 out of 508003 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
o7dqub.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o7fqy.cc cc 7d, 5h 1.00 1.00 0 0 0.00 -
o7opmn.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o7x8kj.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o803rf.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o80fk7.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o834l.cc cc 7d, 5h 1.00 1.00 0 0 0.00 -
o85d3i.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o8n0s7.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o9rszh.us us 7d, 5h 1.00 1.00 0 0 0.00 -
o9w0xt.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oac31w.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakbrookdryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakdaledryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakforestdryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakmontgaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakviewairductcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakviewdryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakviewgaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakvillegaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oakwoodgaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oaliq.studio studio 7d, 5h 1.00 1.00 0 0 0.00 -
oaodtz.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oaqcq.top top 7d, 5h 1.00 1.00 0 0 0.00 -
oardsf.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oav01x.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oazcjq.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oazlh0.us us 7d, 5h 1.00 1.00 0 0 0.00 -
obedient-big-rig-accident-attorney-near-me-0225.top top 7d, 5h 1.00 1.00 0 0 0.00 -
oberlindryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
obgacd.cc cc 7d, 5h 1.00 1.00 0 0 0.00 -
obgacd.click click 7d, 5h 1.00 1.00 0 0 0.00 -
obiektywizm.com com 7d, 5h 1.00 1.00 0 0 0.00 -
obj8r3.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oblivraquorlith.com com 7d, 5h 1.00 1.00 0 0 0.00 -
obozy4m.xyz xyz 7d, 5h 1.00 1.00 0 0 0.00 -
oc1ya8.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oc5432.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oceanfronter.com com 7d, 5h 1.00 1.00 0 0 0.00 -
ocean-impact.cloud cloud 7d, 5h 1.00 1.00 0 0 0.00 -
ocr82v.us us 7d, 5h 1.00 1.00 0 0 0.00 -
octopusdesignandsolutions.com com 7d, 5h 1.00 1.00 0 0 0.00 -
odax5if31m.com com 7d, 5h 1.00 1.00 0 0 0.00 -
odessadryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
odha7a.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oding.shop shop 7d, 5h 1.00 1.00 0 0 0.00 -
odmmf5.us us 7d, 5h 1.00 1.00 0 0 0.00 -
odoservice.top top 7d, 5h 1.00 1.00 0 0 0.00 -
odou8f.us us 7d, 5h 1.00 1.00 0 0 0.00 -
odua2s.us us 7d, 5h 1.00 1.00 0 0 0.00 -
odu-cbpa.org org 7d, 5h 1.00 1.00 0 0 0.00 -
oe0dsa.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oehfwe.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oeju8h.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oeor.net net 7d, 5h 1.00 1.00 0 0 0.00 -
oepullks.top top 7d, 5h 1.00 1.00 0 0 0.00 -
oezygacm5wpb.com com 7d, 5h 1.00 1.00 0 0 0.00 -
ofertaslaborales101.com com 7d, 5h 1.00 1.00 0 0 0.00 -
ofl4bm.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ofn4ax.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oftalmologia-y-enfermedades-oculares-en-ancianos-7181.buzz buzz 7d, 5h 1.00 1.00 0 0 0.00 -
oftr8z.us us 7d, 5h 1.00 1.00 0 0 0.00 -
og533e.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ogd1my.xyz xyz 7d, 5h 1.00 1.00 0 0 0.00 -
oggok.top top 7d, 5h 1.00 1.00 0 0 0.00 -
ogli7r.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ognh1k.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ohaeez.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oi1vmp.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oig215.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oixkld.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oizevr.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ojij54.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ojnazn.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ojnnp2.us us 7d, 5h 1.00 1.00 0 0 0.00 -
ok14j2.us us 7d, 5h 1.00 1.00 0 0 0.00 -
okcentre.org org 7d, 5h 1.00 1.00 0 0 0.00 -
okcfence.net net 7d, 5h 1.00 1.00 0 0 0.00 -
okdesign.xyz xyz 7d, 5h 1.00 1.00 0 0 0.00 -
okdkvo.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oklqps.studio studio 7d, 5h 1.00 1.00 0 0 0.00 -
oklyj6.us us 7d, 5h 1.00 1.00 0 0 0.00 -
okxlg.fun fun 7d, 5h 1.00 1.00 0 0 0.00 -
ol5uhm.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olaedj.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olalladryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oldbethpagedryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oldbethpagegaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oldmonroegaragedoorrepair.us us 7d, 5h 1.00 1.00 0 0 0.00 -
oldwestburydryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olisrd.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olivebluecherrygold.top top 7d, 5h 1.00 1.00 0 0 0.00 -
olivevioletlilacgold.top top 7d, 5h 1.00 1.00 0 0 0.00 -
oll3v2.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olliepromoverao.shop shop 7d, 5h 1.00 1.00 0 0 0.00 -
oltall.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olympiafieldsdryerventcleaning.us us 7d, 5h 1.00 1.00 0 0 0.00 -
olympics2025.com com 7d, 5h 1.00 1.00 0 0 0.00 -
omfitstudiogo.com com 7d, 5h 1.00 1.00 0 0 0.00 -
omfitstudioinfo.info info 7d, 5h 1.00 1.00 0 0 0.00 -

Showing 276401 - 276500 out of 508003 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig