porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 324401 - 324500 out of 502785 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
olpgvbgcffukpqb.cc cc 1d, 8h 7.99 7.99 0 1 0.00 -
olpihp.cfd cfd 19d, 7h 1.00 1.00 0 0 0.00 -
olpju.win win 17d, 7h 1.00 1.00 0 0 0.00 -
olpkt.irish irish 5d, 10h 7.99 7.99 0 1 0.00 -
olpld.pink pink 3d, 9h 7.99 7.99 0 1 0.00 -
olppi.yachts yachts 21d, 7h 1.00 1.00 0 0 0.00 -
olpy13.us us 7d, 7h 1.00 1.00 0 0 0.00 -
olpz7p.sbs sbs 17d, 7h 1.00 1.00 0 0 0.00 -
olq26m.us us 5d, 7h 1.00 1.00 0 0 0.00 -
olq75v.us us 4d, 7h 1.00 1.00 0 0 0.00 -
olr1.top top 17d, 7h 1.00 1.00 0 0 0.00 -
olr6p0.us us 10d, 7h 1.00 1.00 0 0 0.00 -
olr8ga.sbs sbs 22d, 7h 1.00 1.00 0 0 0.00 -
olrhufdev.forum forum 7d, 12h 7.99 7.99 0 1 0.00 -
olrke.bid bid 21d, 7h 1.00 1.00 0 0 0.00 -
olruf.org org 4d, 10h 7.99 7.99 0 1 0.00 -
ols5pr.cfd cfd 10d, 7h 1.00 1.00 0 0 0.00 -
olsbt.club club 21d, 7h 1.00 1.00 0 0 0.00 -
olsinwebdesign.com com 3d, 7h 1.00 1.00 0 0 0.00 -
olskgejs.icu icu 2d, 12h 7.99 7.99 0 n/a 0.00 -
olsof.run run 1d, 7h 1.00 1.00 0 0 0.00 -
olsru.bid bid 22d, 7h 1.00 1.00 0 0 0.00 -
olstwfhfij.blog blog 23d, 7h 1.00 1.00 0 0 0.00 -
olsulr.us us 1d, 7h 1.00 1.00 0 0 0.00 -
olszzz.cfd cfd 22d, 7h 1.00 1.00 0 0 0.00 -
olt044.us us 16d, 7h 1.00 1.00 0 0 0.00 -
oltall.us us 7h, 6m 1.00 1.00 0 0 0.00 -
oltieg.sbs sbs 15d, 7h 1.00 1.00 0 0 0.00 -
oltj632cb1.bond bond 2d, 12h 7.99 7.99 0 n/a 0.00 -
oltk.studio studio 4d, 9h 7.99 7.99 0 1 0.00 -
oltof.com com 14d, 7h 1.00 1.00 0 0 0.00 -
oltqxx.com com 3d, 7h 1.00 1.00 0 0 0.00 -
oluemu.cc cc 2d, 12h 7.99 7.99 0 1 0.00 -
olufi.biz biz 23d, 7h 1.00 1.00 0 0 0.00 -
olu-kai.com com 16d, 7h 1.00 1.00 0 0 0.00 -
olukaideals.shop shop 17d, 7h 1.00 1.00 0 0 0.00 -
olums.me me 22d, 7h 1.00 1.00 0 0 0.00 -
olunabad.sbs sbs 2d, 11h 7.99 7.99 0 1 0.00 -
oluseyeoyede.com com 3d, 7h 1.00 1.00 0 0 0.00 -
oluwayetty.com com 11d, 7h 1.00 1.00 0 0 0.00 -
olux777.com com 17d, 7h 1.00 1.00 0 0 0.00 -
olux777.net net 17d, 7h 1.00 1.00 0 0 0.00 -
olux88.net net 17d, 7h 1.00 1.00 0 0 0.00 -
oluzqw.sbs sbs 21d, 7h 1.00 1.00 0 0 0.00 -
olv30w9.shop shop 5d, 11h 7.99 7.99 0 1 0.00 -
olva95.com com 20d, 7h 1.00 1.00 0 0 0.00 -
olvh5go.cc cc 5d, 10h 7.99 7.99 0 1 0.00 -
olvpn.com com 3d, 13h 10.00 10.00 0 1 0.00 -
olvxhk.cfd cfd 18d, 7h 1.00 1.00 0 0 0.00 -
olvxmzu.com com 23d, 7h 1.00 1.00 0 0 0.00 -
olw7ca.us us 7d, 7h 1.00 1.00 0 0 0.00 -
olwm.net net 28d, 7h 1.00 1.00 0 0 0.00 -
olwqvc.sbs sbs 23d, 7h 1.00 1.00 0 0 0.00 -
olwwz.top top 22d, 7h 1.00 1.00 0 0 0.00 -
olx168.info info 6d, 7h 1.00 1.00 0 0 0.00 -
olx9yo.us us 2d, 7h 1.00 1.00 0 0 0.00 -
olxhk.blog blog 12d, 7h 1.00 1.00 0 0 0.00 -
olxhk.email email 10d, 7h 1.00 1.00 0 0 0.00 -
olxhk.help help 10d, 7h 1.00 1.00 0 0 0.00 -
olxhki.art art 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.blog blog 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.bond bond 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.cfd cfd 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.click click 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.com com 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.help help 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.info info 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.life life 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.makeup makeup 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.net net 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.one one 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.org org 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.pro pro 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.sbs sbs 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.top top 12d, 7h 1.00 1.00 0 0 0.00 -
olxhki.xyz xyz 12d, 7h 1.00 1.00 0 0 0.00 -
olxhk.life life 12d, 7h 1.00 1.00 0 0 0.00 -
olxhk.makeup makeup 12d, 7h 1.00 1.00 0 0 0.00 -
olxhk.mom mom 12d, 7h 1.00 1.00 0 0 0.00 -
olxhk.quest quest 12d, 7h 1.00 1.00 0 0 0.00 -
olxol3.us us 24d, 7h 1.00 1.00 0 0 0.00 -
olxtoto222.com com 27d, 7h 1.00 1.00 0 0 0.00 -
olxtoto66.com com 1d, 7h 1.00 1.00 0 0 0.00 -
olxx2o.cfd cfd 10d, 7h 1.00 1.00 0 0 0.00 -
oly1wb.sbs sbs 23d, 7h 1.00 1.00 0 0 0.00 -
olyhfr.us us 8d, 7h 1.00 1.00 0 0 0.00 -
olyicf.cfd cfd 24d, 7h 1.00 1.00 0 0 0.00 -
olyjej.us us 16d, 7h 1.00 1.00 0 0 0.00 -
olyjsl.sbs sbs 17d, 7h 1.00 1.00 0 0 0.00 -
olylogic.com com 5d, 12h 7.99 7.99 0 1 0.00 -
olymp80.com com 3d, 8h 7.99 7.99 0 1 0.00 -
olympas.sbs sbs 1d, 7h 1.00 1.00 0 0 0.00 -
olympexchange.com com 7d, 7h 1.00 1.00 0 0 0.00 -
olymp-fitness.club club 20d, 7h 1.00 1.00 0 0 0.00 -
olympiaacoffee.com com 3d, 7h 1.00 1.00 0 0 0.00 -
olympia.cc cc 5d, 2h 69.00 69.00 0 2 0.00 -
olympiafieldsdryerventcleaning.us us 7h, 6m 1.00 1.00 0 0 0.00 -
olympians.xyz xyz 1d, 12h 2,999.99 2,999.99 0 1 0.00 -
olympiapvr.com com 2d, 12h 7.99 7.99 0 2 0.00 -
olympicpe.com com 14d, 7h 1.00 1.00 0 0 0.00 -

Showing 324401 - 324500 out of 502785 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig