porkbun.com | Porkbun Auctions

Search Our Auctions

beta


Showing 95001 - 95100 out of 495836 results.

previous | next

Please note that revenue and visitor numbers are pull from parking providers for the duration that the domain has been parked and may not reflect future performance.

Domain TLD Time Left Starting Price Current Bid Bids Domain Age Revenue Visitors
soz2pk.us us 2d, 22h 1.00 1.00 0 0 0.00 -
sp7izm.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spaceallsearch.top top 2d, 22h 1.00 1.00 0 0 0.00 -
spacemail.org org 2d, 22h 1.00 1.00 0 0 0.00 -
spandabuy.co co 2d, 22h 1.00 1.00 0 0 0.00 -
sparrowspointchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spawellnessmagazin.com com 2d, 22h 1.00 1.00 0 0 0.00 -
specials.top top 2d, 22h 1.00 1.00 0 0 0.00 -
spectrum-coverage-map.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
spectrum-near-me.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
spectrum-store-near-me.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
specttech.store store 2d, 22h 1.00 1.00 0 0 0.00 -
speedibook.com com 2d, 22h 1.00 1.00 0 0 0.00 -
speedplus.info info 2d, 22h 1.00 1.00 0 0 0.00 -
spicynewsletter.top top 2d, 22h 1.00 1.00 0 0 0.00 -
spicynews.top top 2d, 22h 1.00 1.00 0 0 0.00 -
spiderman.life life 2d, 22h 1.00 1.00 0 0 0.00 -
spinningcat.top top 2d, 22h 1.00 1.00 0 0 0.00 -
spiqw2.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spmoju.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spoepe.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spotify-web-player.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
spotswoodchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spreearchitect.online online 2d, 22h 1.00 1.00 0 0 0.00 -
springchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
springfieldgardenschimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
springvalleychimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spxxkl.us us 2d, 22h 1.00 1.00 0 0 0.00 -
spystories.net net 2d, 22h 1.00 1.00 0 0 0.00 -
spywaretoday.com com 2d, 22h 1.00 1.00 1 0 0.00 -
sq56cn.us us 2d, 22h 1.00 1.00 0 0 0.00 -
squawvalleychimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
sqvqp.run run 2d, 22h 1.00 1.00 0 0 0.00 -
sqyzhgtoold.buzz buzz 2d, 22h 1.00 1.00 0 0 0.00 -
sr2llm.us us 2d, 22h 1.00 1.00 0 0 0.00 -
sratqh.us us 2d, 22h 1.00 1.00 0 0 0.00 -
srm6iw.us us 2d, 22h 1.00 1.00 0 0 0.00 -
srtc218.com com 2d, 22h 1.00 1.00 0 0 0.00 -
ss1e2t.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssazky.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssba436.xyz xyz 2d, 22h 1.00 1.00 0 0 0.00 -
ssboshi33.homes homes 2d, 22h 1.00 1.00 0 0 0.00 -
ssbtindustries.com com 2d, 22h 1.00 1.00 0 0 0.00 -
ssfgamers.top top 2d, 22h 1.00 1.00 0 0 0.00 -
sshw13.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssib1b.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssonlinebd.com com 2d, 22h 1.00 1.00 1 0 0.00 -
ssp594.xyz xyz 2d, 22h 1.00 1.00 0 0 0.00 -
sspeup.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssyjsy.top top 2d, 22h 1.00 1.00 0 0 0.00 -
ssyp97.us us 2d, 22h 1.00 1.00 0 0 0.00 -
ssz8eg.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stacesa.life life 2d, 22h 1.00 1.00 0 0 0.00 -
stactezal.vip vip 2d, 22h 1.00 1.00 0 0 0.00 -
stanhopechimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stanhub.top top 2d, 22h 1.00 1.00 0 0 0.00 -
stantonchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
starflare.life life 2d, 22h 1.00 1.00 0 0 0.00 -
stark-law.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
starkoan.com com 2d, 22h 1.00 1.00 0 0 0.00 -
starseass.top top 2d, 22h 1.00 1.00 0 0 0.00 -
state-farm-home-insurance-coverage.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
steak.icu icu 2d, 22h 1.00 1.00 0 0 0.00 -
steamexpress.top top 2d, 22h 1.00 1.00 0 0 0.00 -
stevemaddensale.com com 2d, 22h 1.00 1.00 0 0 0.00 -
stevemsbuilds.com com 2d, 22h 1.00 1.00 0 0 0.00 -
stevensonranchchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
sthtbc.top top 2d, 22h 1.00 1.00 0 0 0.00 -
stiureoter.top top 2d, 22h 1.00 1.00 0 0 0.00 -
stlbxk.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stockholmchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stockinvestglobal.info info 2d, 22h 1.00 1.00 0 0 0.00 -
stocksandfriends.com com 2d, 22h 1.00 1.00 1 0 0.00 -
stockscpa.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
stoicallytyped.com com 2d, 22h 1.00 1.00 1 0 0.00 -
stokex.me me 2d, 22h 1.00 1.00 0 0 0.00 -
stoneparkchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stoneswar.io io 2d, 22h 1.00 1.00 0 0 0.00 -
stop-sign.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
store-content.com com 2d, 22h 1.00 1.00 0 0 0.00 -
storyline-online.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
stpatrickscathedralado.org org 2d, 22h 1.00 1.00 0 0 0.00 -
streetchimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stridwedding.com com 2d, 22h 1.00 1.00 0 0 0.00 -
stronstech.com com 2d, 22h 1.00 1.00 0 0 0.00 -
struckbylight.net net 2d, 22h 1.00 1.00 0 0 0.00 -
stsguh.us us 2d, 22h 1.00 1.00 0 0 0.00 -
stu4rt.com com 2d, 22h 1.00 1.00 1 0 0.00 -
student-portal.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
studentreliefprogram.org org 2d, 22h 1.00 1.00 0 0 0.00 -
studie10-be.com com 2d, 22h 1.00 1.00 0 0 0.00 -
studio-ghibli-movies.cfd cfd 2d, 22h 1.00 1.00 0 0 0.00 -
stwsystem.top top 2d, 22h 1.00 1.00 0 0 0.00 -
stylevistaua.click click 2d, 22h 1.00 1.00 0 0 0.00 -
stylevistaua.help help 2d, 22h 1.00 1.00 0 0 0.00 -
stylevistaua.icu icu 2d, 22h 1.00 1.00 0 0 0.00 -
stylevistaua.rest rest 2d, 22h 1.00 1.00 0 0 0.00 -
stylevistaua.top top 2d, 22h 1.00 1.00 0 0 0.00 -
su8784.us us 2d, 22h 1.00 1.00 0 0 0.00 -
succasunnachimneysweep.us us 2d, 22h 1.00 1.00 0 0 0.00 -

Showing 95001 - 95100 out of 495836 results.

previous | next


ICANN Logo
Copyright © Porkbun LLC. All rights reserved.
Porkbun is a Top Level Design Company
Made in the USA 🇺🇸
WARNING: This site has been known to cause a mind blowing experience. We recommend you prepare yourself mentally and if possible be sitting down. Side effects may include saving money, letting out a chuckle, and sporadic oinking.
Footer Popup Pig